Did you mean?
Search Results - Showing 12 - 24 Of 37
_maggi-manchurian-recipe.webp "MAGGI MANCHURIAN RECIPE•<br/>Trust us these taste really very Goooood! We coated our manchurian balls with some dried maggi and then fried it which makes them instantly crisp!<br/><br/>Ingredients used are-<br/>For Manchurian balls-<br/>Boiled Maggi-2 packets<br/>Chopped carrot, onion and capsicum<br/>Ginger, garlic and green chillies<br/>Black pepper powder- 1 Tsp<br/>Soy sauce- 1 Tbsp<br/>Vinegar-1 Tbsp<br/>Schezwan chutney- 2 Tsp<br/>Maggi masala of 2 packet maggi<br/>Maida- 1/4 cup<br/>Cornflour- 1/3 cup<br/>Make the manchurian balls out of this and coat them with some dried maggi and fry until crisp on low flame!<br/><br/>For Gravy-<br/>Oil<br/>Ginger, garlic and green chillies-1 Tsp each Veggies- Onion, capsicum and tomatoes<br/>Schezwan chutney- 2 Tsp<br/>Red chilli sauce- 1 Tsp<br/>Tomato ketchup- 1 Tsp<br/>Soy sauce- 1 Tbsp<br/>Vinegar- 1 Tbsp<br/>Cornflour slurry (1 Tbsp cornflour+ water as required)<br/>Mix well the manchurian balls with gravy for 2-3 min on high flame!<br/><br/>#manchurian #manchurianrecipe #maggie #maggi #maggilover #magginoodles #maggirecipes #chineserecipe #indochinese #snackrecipes #recipe #recipeoftheday #foodreels #recipereels #delhi #delhifood #delhifoodie #delhifoodies #food #foodporn #foodie #foodstagram #easyrecipes #quickrecipes #reels")
_tasty-garam-masala-amp-lapatu-chole-masala-124-indian-food.webp "Chaat King India")
⏲ 6 minutes 11 seconds 👁 625.2K
_124-iran-vs-israel-124-palestine-israel-124-israel-plans.webp "SOMOY TV")
⏲ 1 minute 41 seconds 👁 21.1K
_20-124-124-gym-protein-sandwich.webp "जिम प्रोटीन सैंडविच | Gym Protein Sandwich | High Protein Gym Sandwich Recipe | Sandwich Recipe | Quick & Easy To Make Gym Protein Sandwich | Paneer Sandwich Recipe | Breakfast Sandwich Recipe <br/><br/>नाश्ते में कुछ हेल्दी ट्राय करना चाहते हैं तो आज हम आपको बताएंगे हेल्दी जिम प्रोटीन सैंडविच की रेसिपी जो स्वाद बढ़ाने के साथ आपकी हेल्थ को खराब नहीं करेंगे<br/><br/>ingredients <br/><br/>Paneer ( (sliced) - 200 gms<br/>Salt (as per taste)<br/>A pinch of Turmeric Powder<br/>A pinch of Black Pepper (crushed)<br/>A pinch of Coriander Seeds<br/>Oil (For Cooking)<br/>4 Brown Bread (slices)<br/>Hung Curd - ¼ cup<br/>Carrot (grated) - ¼ cup<br/>Green Capsicum (sliced) - ¼ cup<br/>Chaat Masala - ¼ tsp<br/>Coriander & Mint Chutney (for spreading)<br/>Tomato (sliced)<br/>Flax Seeds (roasted)<br/>Lettuce Leaves")
⏲ 3:24 👁 5K
_garam-masala-recipe-124124-authentic-garam-masala-recipe-124124-garam-masala-124124-indian-magic-masala.webp "Bharat Ka khana Returns")
⏲ 9 minutes 54 seconds 👁 342.2K
_video-124-124-dinesh-lal-nirahua-124-shruti-rao-124-garam-masala-124-bhojpuri-movie-song-2022.webp "Wave Music")
⏲ 1 minute 38 seconds 👁 40.6K
_masala-crab-recipy.webp "Masala crab recipy from 11 ladeshi garam masala")
_channamasalagravychannamasalarecipesidedishforpoorisidedishforchappathidinnerrecipesdinner.webp "Usha The Indian Girl")
⏲ 4 minutes 56 seconds 👁 156
_tasty-garam-masala-124-homemade-garam-masala-124-chef-ranveer-brar.webp "Chef Ranveer Brar")
⏲ 9 minutes 11 seconds 👁 1.6M
_patta-gobhi-ki-sabzi.webp "Patta Gobhi ki Sabzi, or Cabbage Stir Fry, is a simple and flavorful Indian dish. Here's a basic recipe:<br/><br/>Ingredients:<br/><br/>1 small cabbage, shredded<br/>1 onion, finely chopped<br/>2 tomatoes, finely chopped<br/>2 green chilies, finely chopped (adjust according to your spice preference)<br/>2 cloves garlic, minced<br/>1-inch piece of ginger, minced<br/>1 teaspoon cumin seeds<br/>1 teaspoon mustard seeds<br/>1/2 teaspoon turmeric powder<br/>1 teaspoon coriander powder<br/>1/2 teaspoon red chili powder (adjust to taste)<br/>Salt to taste<br/>2 tablespoons oil<br/>Fresh coriander leaves for garnish<br/>Instructions:<br/><br/>Heat oil in a pan over medium heat. Add cumin seeds and mustard seeds. Let them splutter.<br/>Add chopped onions and sauté until they turn translucent.<br/>Add minced garlic and ginger. Sauté for another minute until fragrant.<br/>Add chopped green chilies and tomatoes. Cook until tomatoes are soft and mushy.<br/>Add turmeric powder, coriander powder, red chili powder, and salt. Mix well and cook for a minute.<br/>Add shredded cabbage to the pan. Stir to combine with the spice mixture.<br/>Cook the cabbage uncovered for about 7-10 minutes or until it's tender, stirring occasionally.<br/>Once the cabbage is cooked, garnish with fresh coriander leaves.<br/>Serve hot with roti or rice.<br/>Feel free to adjust the spices and seasoning according to your taste preferences. Enjoy your Patta Gobhi ki Sabzi!<br/><br/><br/><br/><br/><br/><br/>")
_11-a-m-indian-burgers-in-miami-florida-david39s-been-here-garam-masala-amp-gun-powder-burgers.webp "Davidsbeenhere")
⏲ 20 minutes 32 seconds 👁 36.5K
_the-best-garam-masala-124-delicious-spice-blend-for-indian-cooking-at-home.webp "Sanjana.Feasts")
⏲ 2 minutes 47 seconds 👁 1.1K
![[+]](/images/menu.gif){kind=small}